Search

Adrian B Ozinsky

from Seattle, WA
Age ~58
Get Report
Related to:
Amy J Ozinsky, 22Gina Ozinsky, 57Sean A Ozinsky, 20
Connected to:
Paul L Ozio, 62Glory O Ozioma, 38Saliha Ozis, 41Kevin Ozkal, 64Aylen Ozkan, 57Devrim Ozkan, 44Ebru G Ozkan, 35Eyup Ozkan, 60Neslihan Ozkan, 59Ozkan Y Ozkan, 45

Adrian Ozinsky Phones & Addresses

  • 4332 Bagley Ave, Seattle, WA 98103 (206) 632-9931
  • 1811 44Th St, Seattle, WA 98103 (206) 632-9931
  • 4332 Bagley Ave N, Seattle, WA 98103 (206) 419-0275

Work

Company: Institute for systems biology Position: Assistant professor

Education

Degree: Bachelor's degree or higher

Emails

g***[email protected]

Industries

Biotechnology

Resumes

Resumes

Adrian Ozinsky Photo 1

Assistant Professor At Institute For Systems Biology

View page
Position:
Assistant Professor at Institute for Systems Biology
Location:
Greater Seattle Area
Industry:
Biotechnology
Work:
Institute for Systems Biology
Assistant Professor

Business Records

Name / Title
Company / Classification
Phones & Addresses
Adrian Ozinsky
Professor School Of Engineering
Institute For Systems Biology
Research and Development in the Social Sciences and Humaniti · Research & Development in Biotechnology
1441 N 34 St, Seattle, WA 98103
(206) 732-1200, (206) 732-1236, (206) 732-1235, (206) 732-1224

Publications

Us Patents

Multiplexed, Microfluidic Molecular Assay Device And Assay Method

View page
US Patent:
8124015, Feb 28, 2012
Filed:
Feb 3, 2006
Appl. No.:
11/346222
Inventors:
Alan Diercks - Seattle WA, US
Adrian Ozinsky - Seattle WA, US
Carl Hansen - Vancouver, CA
Alan Aderem - Seattle WA, US
Assignee:
Institute for Systems Biology - Seattle WA
International Classification:
G01N 15/06
US Classification:
422 681, 422 8201, 436149, 436518, 436526
Abstract:
Microfluidic systems are disclosed, including microfluidic devices and methods, useful for simultaneously analyzing multiple analytes in each of a plurality of distinct nanoliter-volume samples.

Toll-Like Receptor 5 Ligands And Methods Of Use

View page
US Patent:
20030044429, Mar 6, 2003
Filed:
Apr 17, 2002
Appl. No.:
10/125692
Inventors:
Alan Aderem - Seattle WA, US
Fumitaka Hayashi - North Quincy MA, US
Kelly Smith - Seattle WA, US
David Underhill - Seattle WA, US
Adrian Ozinsky - Seattle WA, US
International Classification:
A61K048/00
A61K039/02
A61K031/715
C12N009/00
US Classification:
424/234100, 435/183000, 514/044000, 514/054000
Abstract:
The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.

Toll-Like Receptor 5 Ligands And Methods Of Use

View page
US Patent:
20050147627, Jul 7, 2005
Filed:
Nov 16, 2004
Appl. No.:
10/991347
Inventors:
Alan Aderem - Seattle WA, US
Fumitaka Hayashi - Kinnelon NJ, US
Kelly Smith - Seattle WA, US
David Underhill - Seattle WA, US
Adrian Ozinsky - Seattle WA, US
International Classification:
A61K039/02
C12N009/00
C07K014/195
US Classification:
424242100, 435183000, 530350000
Abstract:
The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:49) or EQAAKTTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITNLGNTVNNLSS (SEQ ID NO:50), or a modification thereof. Further provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAE ITQ (SEQ ID NO:44) and substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding. Methods of using immunomodulatory flagellin peptides additionally are provided.

Toll-Like Receptor 5 Ligands And Methods Of Use

View page
US Patent:
20110008318, Jan 13, 2011
Filed:
Aug 24, 2009
Appl. No.:
12/546593
Inventors:
Alan Aderem - Seattle WA, US
Fumitaka Hayashi - North Quincy MA, US
Kelly D. Smith - Seattle WA, US
David M. Underhill - Seattle WA, US
Adrian Ozinsky - Seattle WA, US
International Classification:
A61K 39/395
A61K 39/00
C07K 14/195
C07K 14/52
C07K 14/00
C12N 1/20
A61P 37/04
US Classification:
4241301, 4241851, 530350, 530351, 530395, 435243
Abstract:
The invention provides an immunomodulatory flagellin peptide having at least about 10 amino acids of substantially the amino acid sequence GAVQNRFNSAIT, or a modification thereof, and having toll-like receptor 5 (TLR5) binding. Methods of inducing an immune response are also provided.

Automated Analysis Of Images Using Bright Field Microscopy

View page
US Patent:
20110254943, Oct 20, 2011
Filed:
Apr 4, 2011
Appl. No.:
13/079776
Inventors:
Adrian Ozinsky - Seattle WA, US
Jyrki Juhani Selinummi - Nokia, FI
Ilya Shmulevich - Seattle WA, US
Pekka Ruusuvuori - Pori, FI
Assignee:
Institute for Systems Biology - Seattle WA
International Classification:
H04N 7/18
G06K 9/00
US Classification:
348 79, 382133, 348E07085
Abstract:
A system and method for automatically observing and counting cells without using a stain or a fluorescent material. The system includes an optical microscope having a sensor that provides an electrical signal representative of a field of view. The microscope is motorized so as to allow automatic change of focus. A sample containing cells to be analyzed is provided. No stain or fluorescent substance is used. When the microscope is operated in a deliberately out-of-focus condition, cells appear to have either a bright or a dark spot that can be used to report the number of cells in the sample. The intensity variation detected in images acquired in different focal planes is used to identify cell shapes using image analysis software such as CellProfiler. A result is reported in any convenient format, such as a false color image.

Toll-Like Receptor 5 Ligands And Methods Of Use

View page
US Patent:
20120269855, Oct 25, 2012
Filed:
Jul 26, 2011
Appl. No.:
13/191093
Inventors:
Alan Aderem - Seattle WA, US
Fumitaka Hayashi - North Quincy MA, US
Kelly D. Smith - Seattle WA, US
David M. Underhill - Seattle WA, US
Adrian Ozinsky - Seattle WA, US
Assignee:
University of Washington - Seattle WA
The Institute For Systems Biology - Seattle WA
International Classification:
A61K 39/39
C07K 14/21
C07K 14/195
C07K 14/24
C07K 14/255
A61P 31/04
C07K 14/25
C07K 14/20
C07K 14/32
C07K 14/33
A61K 39/02
A61P 37/04
C07K 14/28
C07K 14/245
US Classification:
4242341, 530350, 4242821, 4241841
Abstract:
The invention provides methods to elicit an immune response with an immunomodulatory flagellin polypeptide having toll-like receptor 5 (TLR5) binding, and further comprising an ADCC targeting molecule.
Control profile
Adrian B Ozinsky from Seattle, WA, age ~58 Get Report